DPCstruct | MC46790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 392 ± 64 aa |
| Standard deviation of domain lengths | 64.40 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 26.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0220- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1QQ64 | 2-450 | NFFFTQLFAPSAPGSALYDRVERMFRVERHSLRIFWEGRPLAEADVLCDVCVIPDDDRLNLELEFDVTPEFLRMVNAGEQVLRSVEV… |
| A0A7S0VK68 | 44-430 | QQMQLQLQMMQRQNDYIREKFRAIDVEIDQGPDIPRHLIQVLLDYTQMDRKPYLGGFKHKLTSVVYHHASTQTPRQPKYTEADRKLS… |
| A0A7R9IY89 | 148-703 | None |
| A0A024G4P3 | 585-894 | None |
| A0A812WGR8 | 148-600 | None |
| A0A2P6NG32 | 315-691 | None |
| A0A1X7T298 | 39-486 | None |
| C1E0T6 | 160-588 | None |
| A0A3Q4HB78 | 3-390 | None |
| A0A2P6TL98 | 5-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.