DPCstruct | MC4679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 127 ± 16 aa |
| Standard deviation of domain lengths | 15.87 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 22.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E3R2Q5 | 1-114 | MSEYRTLPVRHHFTEADLDAFADRAAHAVREVADLEDEKRETAKEFKTRIDALHSEIRDLSRRRREGFEMVPTSCRLRRDHGTQMRQ… |
| A0A522CGL5 | 1-100 | MRVPLTDPELIAVGADLSALITKEAAVEAEKKAVTKVFSDQLKELHASIMVMNQSIATKSVEREVEVRIEEDHLRGVIRTIRLDTNQ… |
| T2GB11 | 98-236 | None |
| A0A6I1KHW1 | 13-147 | None |
| A0A0F9NDC9 | 49-164 | None |
| A0A2T7BBN3 | 1-144 | None |
| I6AWG2 | 1-148 | None |
| A0A7K1SKU1 | 1-139 | None |
| A0A418M254 | 1-115 | None |
| G1V632 | 173-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.