DPCstruct | MC46781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 124 ± 11 aa |
| Standard deviation of domain lengths | 10.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W6FJM8 | 4-131 | FPRISLRPEVTEYLKNVFLNKEVLAAVGQQEAESRFHKLLICLSHPPSYTCVRASTHLASLEEIRHKLGEELKKQMCSSSAEEFSPQ… |
| A0A452RIP2 | 2-111 | SVFPKISLRLEVEKYLKEGFMNKEIVSAFGKQAAERKFETLLNHLSHPPSFTTVRVNTHLASVQHVKDLLFDELQKQFNGLNVPILQ… |
| A0A224Z1S5 | 25-124 | None |
| A0A7J7ZDE8 | 2-130 | None |
| A0A453SFC2 | 6-123 | None |
| A0A7S0YA89 | 4-134 | None |
| A0A0A9BQZ1 | 21-164 | None |
| B8BA85 | 25-140 | None |
| W2MM22 | 3-122 | None |
| A0A6A4S4M0 | 415-549 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.