DPCstruct | MC46779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 67 ± 3 aa |
| Standard deviation of domain lengths | 2.81 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 46.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19289 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381GV31 | 2-70 | AGGIHNWRIPGQGLSFEQLLKEMGTGLVVTELMGQGVSGITGDYSRGAAGFWVENGEIQYPVSEITIRR |
| A0A6M1CKZ0 | 123-191 | AGGIHNWHIAGQGLGFDDMLREMGTGLVVTELMGQGVSGITGDYSRGASGFWVENGEIQYPVSEITIAG |
| A0A6J6BF62 | 67-135 | None |
| A0A833CYH9 | 120-183 | None |
| A0A7V2ADH6 | 1-62 | None |
| A0A7C6BBW4 | 22-90 | None |
| A0A3S4VMP4 | 17-86 | None |
| A0A6A6JZ57 | 26-92 | None |
| A0A7S7G0R0 | 1-63 | None |
| A0A379WGV2 | 27-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.