DPCstruct | MC46774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 102 ± 14 aa |
| Standard deviation of domain lengths | 13.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.70 |
| Pfam Score | 97.17 |
| Assigned Pfam label(s) | PF15846- CL0016- PF01158- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4Z9T3 | 55-154 | WKRGGAGIMTAGQAVGLTKGHIVTKKALVPKVSHRKGALGKRTQFVRSLIREVVGFAPYEKRIIELLRIGKDKRALKFAKKRLGTHL… |
| G7MYL0 | 3-103 | LRYPMAVGLNKGHKVTKNVSKPRHSRRRGRQSKHTKFVRDMIREVCGFIPYELRAMGLLKVSKEKRALKFIKKRVGTHIRAKRKQEE… |
| A0A0D3D7K9 | 36-155 | None |
| A0A0J6YQC8 | 73-186 | None |
| A0A6D2HSD2 | 135-245 | None |
| A0A1S3P9C7 | 22-129 | None |
| L9J9M2 | 16-99 | None |
| A0A140T8U4 | 17-117 | None |
| A0A817QYG1 | 6-132 | None |
| A0A1Q9E7R3 | 92-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.