DPCstruct | MC46772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 131 ± 21 aa |
| Standard deviation of domain lengths | 20.98 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.74 |
| Pfam Score | 86.71 |
| Assigned Pfam label(s) | PF16201- PF06415- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4Z1I2 | 451-567 | GTTEFGHVLFDAGRDVPTDLVLINRAVEKNLFASNPAFKAAVEVAKNGGTIHCMGVLSDGLVHSSMKHIEAMLKTLKDSGAASSSIA… |
| A0A380DP65 | 1-98 | MGNSEVGHMNIGAGRIVYQSLTRINKSIEDGDFFENDVLNNAIAHVNSHDSALHIFGLLSDGGVHSHYKHLFALLELAKKQGVEKVY… |
| A0A2V4NWV3 | 12-134 | None |
| A0A4S8IE37 | 23-132 | None |
| A0A644SWC1 | 353-491 | None |
| A0A7V0KIQ0 | 186-326 | None |
| A0A0C3DYH4 | 55-176 | None |
| A0A836AUN9 | 499-672 | None |
| A0A2G9ZM99 | 89-236 | None |
| A0A4Y7LDF0 | 78-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.