DPCstruct | MC46771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 152 ± 29 aa |
| Standard deviation of domain lengths | 28.66 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09349 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q8ABU1 | 8-149 | ERLAGIFERAPGLGERVARRVPSDEPDAIVATARDELARMSERERIAVLDAHPRIGADPAELSERSRAEQGHAESATVLRELAALND… |
| A0A5J4YQ15 | 18-186 | TVLDNVLPENEVRDALLSCCRCTAWANTLAEGRPFLSADQLFECAQLQWQKASEADVLEAIKAHPRIGERKGESNKHADKLSQSWSE… |
| A0A7C3ZSE1 | 184-352 | None |
| A0A4Y3R6N1 | 18-178 | None |
| A0A1J8QJY8 | 278-478 | None |
| A0A177VRW1 | 4-228 | None |
| A0A1G9LGX6 | 7-177 | None |
| A0A511D3B8 | 4-190 | None |
| A0A445CAV2 | 3-147 | None |
| A0A1H5FYQ1 | 46-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.