DPCstruct | MC4677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 98 ± 6 aa |
| Standard deviation of domain lengths | 6.36 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6UM71 | 2-87 | FIGDVFNYGSDTEGYDMELELLSRVAYDVFALPTLNTQIALWAYGYTNYPRNILDALNKMTKNYDEFDQLLLRMDYANVSDVINTE |
| A0A3P7PY17 | 8-95 | ITALEGIHCVFVADLLNLGLNQTTYDKEWNLTAHIANYFENARIRSSGGLWTYGYNMRAQHEDFNDVFKNMSTNWADFATNAKQYLKV |
| A0A016TVK7 | 208-310 | None |
| A0A0B1TDR8 | 237-335 | None |
| A0A0B1STB8 | 12-109 | None |
| A0A0B1ST57 | 22-109 | None |
| W2SEW3 | 96-191 | None |
| A0A0B1TR16 | 24-123 | None |
| A0A0B1TJD0 | 148-256 | None |
| A0A0B1TJ27 | 119-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.