DPCstruct | MC46764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 291 ± 33 aa |
| Standard deviation of domain lengths | 33.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369L167 | 1-299 | MRQGMLDGMEDMTLMEQLPYWAGFSVVAGVVSLMEVLFLYWNALRGVAQTSQVAGIPLQDSEHARLLLSGMSRVALELPSPRHRIYG… |
| K3WC35 | 63-382 | TSFVESHSGFVHCVCVVLINIAVSIFEVNGMYLTAVVCAFRLTVCTNPKLYPQDAEREFLARSIARAALQVGHRKDKIFGIDPMKGS… |
| A0A2T3HZL0 | 64-323 | None |
| A0A830HS73 | 208-557 | None |
| A0A813A6B8 | 158-409 | None |
| A0A225VGQ5 | 111-431 | None |
| A0A150SBV7 | 1-246 | None |
| A0A4U1JJZ3 | 1-278 | None |
| W0DT67 | 76-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.