DPCstruct | MC4676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 6.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 53.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X0RRQ7 | 3-68 | LRMKLLQFTEDVRPAYYGTFTQKSSVITGKTPFAQDTSNFDYEVDSEAEWEPEGEGEEINSGDEDE |
| A0A3P7PVC8 | 1-67 | MRAKLYQFHDNYRPPYYGTWRTRSKVITGRRPFSNVEEKIDYEVDSDAEWEEEPSDADECKSDEEVT |
| A0A7S2XVB8 | 14-95 | None |
| A0A4Z2CU53 | 105-167 | None |
| H2ZDV8 | 4-77 | None |
| A0A183PLD2 | 35-101 | None |
| K7HYZ8 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.