DPCstruct | MC4675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 54 ± 3 aa |
| Standard deviation of domain lengths | 2.52 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 59.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9JWD2 | 164-218 | VDFVRPNYLGTKTEFCNMFERPIQNGQCIDSTPQDIRLMRYRAHVLHSLLEGFVQ |
| A0A2H1BTN1 | 105-159 | VDFVRPNYLGTKQEFTNMFQRPIENGQCIDSTPEDRKIMQGRAHVLHDLLSGFVQ |
| A0A3P7LGS1 | 161-214 | None |
| T1JR14 | 1-55 | None |
| K1PIE8 | 105-153 | None |
| A0A654GNR4 | 170-220 | None |
| A0A183J849 | 27-81 | None |
| A0A2D4HG96 | 128-183 | None |
| E9IHD3 | 1-55 | None |
| A0A1Y3ED30 | 248-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.