DPCstruct | MC46748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 165 ± 39 aa |
| Standard deviation of domain lengths | 39.45 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 74.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S9RKK3 | 143-350 | TIGTSNVPIKCVWMDSDHSNGIIAKGLSLHMRSFAGDQGLVNQYQEDQRRLCQNTARMTFQPEPVVPDSIPRFFKHAPEFDDTGALK… |
| A0A4V4K317 | 57-160 | TGVLIPNLTSRRAWMEQRLIVSDLPGHSARYLCDSATSYGPDFVGNDTMFCDMGTKSLLPLCSPDDVLDCFELDRVAQVVVIKRAFG… |
| A0A1Q8RPU1 | 51-202 | None |
| A0A178ECZ9 | 263-412 | None |
| A0A179IHI5 | 45-189 | None |
| A0A0G2HWY9 | 38-210 | None |
| W9WG65 | 68-222 | None |
| A0A423VSS8 | 128-307 | None |
| A0A2H2Z8M4 | 1-103 | None |
| W9WLU7 | 739-929 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.