DPCstruct | MC46747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 425 ± 47 aa |
| Standard deviation of domain lengths | 46.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S6UPH8 | 567-989 | GQVGRFTKETTYKFNKGLHRNDPVLAAIYSQIIALRKKDIGFFAIKLEANPVNDAPPLWPPGRNLFDAKAYHFKPKDKYGEKEMFWV… |
| A0A6A5YUN4 | 55-468 | QADPVLRVIKQTIRELCRDEPYLAAAEVQVWNATSSPPLWPLSQANRDIGIKFYLFKETYDEFHATHPVRVIPSGRGLTADMIEVRH… |
| A0A6A6GFE5 | 49-461 | None |
| A0A6A5VDB6 | 129-691 | None |
| A0A4U0XP04 | 33-410 | None |
| Q0U1P9 | 93-545 | None |
| A0A0F4G525 | 28-470 | None |
| A0A2P7ZQB7 | 1-359 | None |
| A0A4Q4S6G9 | 146-600 | None |
| A0A3M7MJ13 | 550-1005 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.