DPCstruct | MC46744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 71 ± 8 aa |
| Standard deviation of domain lengths | 8.49 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 30.79 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0192- CL0036- CL0288 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U3UB44 | 57-116 | VVAIKDESIIGTLFEGVPMESVRVGDYDAIVPAIEGWARVTGHNTIFVDDRDPLAHGFLL |
| A0A6N6XH52 | 38-103 | ACLAADGKLEPGKLWKQASIIGSQFIASYEQAGEYVIPTIRGEAYMSAEATLFMDENDPFAWGIQL |
| A0A7X3MII5 | 59-126 | None |
| A0A136L3W4 | 4-76 | None |
| A0A5N6G3T6 | 160-231 | None |
| A0A418X9Z5 | 66-161 | None |
| A0A446CKB3 | 6-74 | None |
| A0A7C4A4K1 | 1-63 | None |
| A0A1K2E7K5 | 22-79 | None |
| A0A090EHX8 | 69-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.