DPCstruct | MC46742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 115 ± 12 aa |
| Standard deviation of domain lengths | 12.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 17.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18602 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4MAE4 | 9-116 | CTLATPVCAFAFTGNDLNKLCTKTDPSPRTACAAYIEGAADGIYNTIEAIGGTSGPQVGQYFCLPADVKPQQLTDAVRKYITNNPDK… |
| A0A847KPH6 | 2-96 | TAGNFGRICTSRGGAQICDAYITGMADAGALSKINAANNGDASAQAGFCIPQSTTGTDLRSKVVSWLKAHKDELSKPVGETVFVALH… |
| A0A830QCS2 | 33-136 | None |
| A0A7G4RJE2 | 2-129 | None |
| A0A2E6RMU3 | 1-111 | None |
| A0A1C3UMB3 | 66-200 | None |
| A0A2V1JYB1 | 27-169 | None |
| A0A7U2V5W8 | 2-113 | None |
| A0A2E7DE80 | 67-189 | None |
| A0A4V2RFT2 | 17-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.