DPCstruct | MC46740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 191 ± 29 aa |
| Standard deviation of domain lengths | 28.51 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 16.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8CG40 | 7-201 | VSRPGYVGPGGLFPVAISKCLYDNYWNSSTNSPKLATSTAPISGQTVNQTPNTPYVFQILSTYQANGCDAGQWTTLTSQQNDVPFVR… |
| A0A1F6L955 | 100-291 | LLILHSAKPVPFLFLPDRVVLNVSMAAVIPQVVYGLSGLVPFAVVAPEGGFVYGELYTLKFGGGDGQTGNYGALALDGSGASNYLDK… |
| A0A7Y4XAV8 | 2-158 | None |
| A0A521UDT4 | 158-412 | None |
| A0A521UE33 | 142-366 | None |
| A0A7X2PNV8 | 2-234 | None |
| A0A7K3WAR9 | 165-327 | None |
| A0A838RM34 | 978-1143 | None |
| A0A7V9TQH8 | 25-212 | None |
| A0A837IEI2 | 278-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.