DPCstruct | MC4674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Standard deviation of domain lengths | 9.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S4WKG5 | 2-93 | IENLIKASKRSSHADQLWELIKDEMYCLELVPILDIGKPSASHLSNDYPNSPDITDLEIKLVQSICDQNHISTLNTSMQWDTKVFDL… |
| A0A3P7P2U2 | 1-101 | MRARSCQGFAIISEDLGIVQPVMGTLESQQLHLGYGDRSVTCYHSENINEADVEKIDSFCKAKELELWNTRLFKDLQKRDGKTVYRL… |
| A0A4Y2LPP4 | 1-108 | None |
| A9SKT4 | 187-287 | None |
| G7Y3C7 | 128-213 | None |
| A0A0S7H9X8 | 119-230 | None |
| A0A3P7PZ12 | 54-157 | None |
| A0A401Q5S2 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.