DPCstruct | MC46736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 219 |
|---|---|
| Mean domain length (aa) | 186 ± 33 aa |
| Standard deviation of domain lengths | 32.97 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 11.83 |
| Pfam Score | 30.30 |
| Assigned Pfam label(s) | PF12991- PF11130- PF11203- PF03135 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2RU58 | 34-201 | LAWDEVGPTATQASWDDYRHDSAFSASWTMTGAPRGSVNSSVLSRLLAPHGDIDRKRISLLYRPMDSARAAAVVERDQNNANVRITS… |
| A0A395VDF0 | 6-181 | TQNKMSVRDFVDAADVKGNFLYRKDGVILAYLRIYFYNIELMNHAERRALSNNLAAQFKADRRDFVYTTLPREVDMDQYRQSLKERH… |
| A0A7X8G1D5 | 29-229 | None |
| A0A4R2S4N8 | 10-211 | None |
| A0A2R9SPL9 | 71-240 | None |
| A0A4Q5J9X0 | 335-570 | None |
| W1I6K4 | 25-189 | None |
| A0A7C0UKJ5 | 49-233 | None |
| A0A7D5YI23 | 28-197 | None |
| A0A0F9NFI8 | 374-567 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.