DPCstruct | MC46732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 222 ± 31 aa |
| Standard deviation of domain lengths | 31.02 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5UHS4 | 541-723 | MILPDGQNSALQSNFSFFELGNRIVSGSRYFLLDKEDHYALVSLESNESIANALMNLDAFQKFHPEKNIYIRAIPMGKDRRDETRRV… |
| A0A2G5U9I5 | 41-216 | VFSQDKYYSLNYFLVRPSLKASEELRYFVVDVQDIKEYQFWIQSSNEFTVRCSLNLDLFCRRHECKKFYIRNLSRFIEDHLFFADEI… |
| G0P7A4 | 38-240 | None |
| A0A2G5TX28 | 427-692 | None |
| A0A2G5URH7 | 1-187 | None |
| A0A2G5URA3 | 1-178 | None |
| A0A2G5UR05 | 10-231 | None |
| A0A2G5UQN3 | 380-590 | None |
| A0A2G5UPV7 | 1-246 | None |
| A0A2G5UMZ3 | 1-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.