DPCstruct | MC4673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 251 ± 35 aa |
| Standard deviation of domain lengths | 34.56 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 66.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.70 |
| Pfam Score | 94.77 |
| Assigned Pfam label(s) | PF04046- CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5CVI4 | 1-201 | MFSTGRKKFNASNDILTNDVPSSSDEKKESTFKVNCFNCDGEHSFQDCELPLDHQRIAANRAVHFNNKRVTQERYTSAGEIGSNSSL… |
| A0A3P7NDI8 | 20-268 | EGRCTPSPEVKKRRVSISCMQSDVMKGSEADYGDFVLDRTESVTLEIDDVRALDSASSSMDSSQWKDKVLASLLTGQEEQNGSPDAK… |
| A0A7R9B1Y7 | 100-393 | None |
| V4AH21 | 36-263 | None |
| A0A5S6QHA1 | 131-405 | None |
| A0A444X9E0 | 1-216 | None |
| A0A6P3FWW4 | 35-281 | None |
| A0A834XML2 | 106-364 | None |
| A0A2I0AE91 | 134-400 | None |
| M0YT66 | 199-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.