DPCstruct | MC46724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 294 ± 66 aa |
| Standard deviation of domain lengths | 65.56 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 50.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11805 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7YI08 | 6-223 | MPNTLYVEGYALDRFAEGAWALQPVHQNKVGLVLDSGIEEELRLRHLQVADAARASLGLPVVEYTVTDAPLEIKTWFDPKCGKSTGS… |
| A0A835Q5T1 | 46-399 | QRPYTTVMVVPTGVGAAIGGYAGDALPVARTLTAVADCVISHPNVLNAAMLYWPMPNILYVEGYALDRFAEGLWALRPVHQNKVGLI… |
| A0A5N6PUS5 | 226-577 | None |
| A0A3L6SVS6 | 88-253 | None |
| A0A7J7L8F4 | 30-299 | None |
| A0A830HL44 | 8-430 | None |
| W7TGI0 | 76-452 | None |
| A0A811PDZ1 | 45-356 | None |
| A0A6P2AYR1 | 53-346 | None |
| A0A2U1QGG8 | 365-714 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.