DPCstruct | MC46722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 148 ± 13 aa |
| Standard deviation of domain lengths | 12.93 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 69.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05602 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6G3P9 | 1-171 | MLRFRDRESYAGNKTKEYDDMAMKYLSYVLFFLVACSSLYSLMYERHRSWYSWILSSLTSCVYMFGFIMMCPQLFINYKLKSVAHLP… |
| A0A086JSZ8 | 77-234 | KKETPKPVAVDFEELQRFENSCMWYLFLLFLPVVIGVSLHQLVYVPQKGWWSWVVTSLATCGYTFGFVSMTPQLFRNYKLQSVTHLP… |
| S9V2B0 | 284-440 | None |
| A0A183KH62 | 250-386 | None |
| G4TZE3 | 208-340 | None |
| F0Y461 | 203-339 | None |
| A0A815D644 | 157-306 | None |
| A0A1C6YGB6 | 467-620 | None |
| A0A2H1C6X8 | 51-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.