DPCstruct | MC46714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 179 ± 16 aa |
| Standard deviation of domain lengths | 16.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498P4J2 | 1-173 | MQADDARYLKRKYKGGSLDVHPTEKALVVQYEVEATILGETGDPMLGERKECQKIIRLKSLNSNTDIASLARKVVEECRLISPSRLP… |
| A0A7S1C9Z9 | 2-205 | DGPAYMKRKVKYGSIDVDLEANSLVVNYEVEAAVLGGHGEVMKNDTKAFKKIIKLKQLNEHSNIPLLAEDVVDKCDLIHEDSLPLVE… |
| A0A2K6CCS2 | 12-162 | None |
| A0A0D8Y8J0 | 8-178 | None |
| A0A1Y1NJ08 | 47-209 | None |
| A0A2J7RMK6 | 1-200 | None |
| A0A6J1LTP6 | 23-220 | None |
| A0A7R8VR10 | 12-205 | None |
| A0A0P7V0L4 | 1-174 | None |
| A0A1S3D3J8 | 1-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.