DPCstruct | MC46712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 125 ± 13 aa |
| Standard deviation of domain lengths | 12.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498P0H6 | 20-145 | PVPALITTGGYGNARKKREILDSNIIGYCVEFKLTSLTVGCQRSFSPHTRWMRYLKEGHQVCVECQPPALVQGQRYCSGDGENMKQD… |
| A0A401RQU2 | 6-93 | CYCAYFRMKEVSPSCRLGLRTSRLFREKYVCVECQGEAMGVRDRCEGDGLEGTRTFWIAASNAGCQGSWVRESLHETCRCPPQSLIFV |
| A0A384DQI7 | 136-263 | None |
| A0A5A9N780 | 128-274 | None |
| A0A6V7WB27 | 393-527 | None |
| A0A0B2UT43 | 285-415 | None |
| A0A2A2KLG8 | 233-363 | None |
| A0A5E4C3L7 | 79-199 | None |
| A0A182MRL8 | 145-276 | None |
| A0A7R9KGU7 | 3-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.