DPCstruct | MC46710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 298 ± 65 aa |
| Standard deviation of domain lengths | 65.06 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498NYU5 | 43-321 | STEEFSPDVIMASLVTGATIILSSYFIHFIYLSRSTKWILAVLGSVFTIMFVLVSCGVFFPYSGDLSSPRPKRVFVQHITRRFHRLD… |
| A0A4X1W2V5 | 681-1000 | LLGMFIPYLYALYLIWAVFEMFTPILGRSGSEIPPDVVLASILAGCTMILSSYFINFIYLAKSTKRTMLTLTLVCTVTFLLVCSGTF… |
| A0A2G3CMJ6 | 89-436 | None |
| A0A7V0S297 | 266-540 | None |
| A0A556TUA6 | 267-687 | None |
| A0A842YQ99 | 205-506 | None |
| A0A7Y2YDY3 | 10-214 | None |
| A0A1Q7HXD3 | 18-250 | None |
| A0A3Q0IYB4 | 105-615 | None |
| A0A817XYF3 | 96-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.