DPCstruct | MC4671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 112 ± 30 aa |
| Standard deviation of domain lengths | 29.98 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2KX99 | 243-337 | VDDGTSPINLVIDSSNGYQFKNNIINTTFTAILYQNNTEIDRDGTEFAYIWTKTNSDGTVDTAWNLAHQTSQKSITITNSDIWQRAT… |
| A0A3D3QXZ2 | 56-145 | VNYRVEITSTNGNLFKNDVIETTLIARVYFGSEDITDSLPQNSFRWKRVSDDSTADIAWNRLHQNLGSNILNIDSDDVDSRAVFNCE… |
| A0A843PD86 | 2-91 | None |
| E1GXW7 | 22-154 | None |
| A0A060RB33 | 36-125 | None |
| A0A1G9KDV4 | 691-778 | None |
| C9A1B1 | 309-459 | None |
| A0A0T7AQ47 | 840-938 | None |
| A0A252F5Y3 | 390-478 | None |
| F3ZS85 | 69-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.