DPCstruct | MC46706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 624 ± 106 aa |
| Standard deviation of domain lengths | 106.01 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498NTJ5 | 27-664 | EDVRCDLLQKADVELSKGQDEIIGKIKSYYEQGEGHVELVESFQQDFINSAKSLKTELLNSITNKLDAALSRRNGMMKFEGIKKTYM… |
| A0A2G8JZK6 | 1-480 | MKKLGVTKYGKVLGKAKGMFYANQKKIVSTIVKTSLVLLQIDIDNDLAFDHAIIKKFVDHTIDALNQKYQEATLTQDTKVNAIVEAY… |
| S7PH71 | 431-1077 | None |
| S4RP40 | 176-740 | None |
| A0A7J6CT35 | 194-770 | None |
| A0A816R8R8 | 144-1005 | None |
| A0A2K1KQJ8 | 136-955 | None |
| I3IS45 | 1116-1800 | None |
| G3NX04 | 124-785 | None |
| A0A6J0VBI0 | 413-1097 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.