DPCstruct | MC46701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 233 ± 34 aa |
| Standard deviation of domain lengths | 34.27 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432XRV1 | 1-287 | MIRVLVDNAVWDWANILDPVTISVSSELKDQPTETMSGYMRKQPLLGSEKWKQEEIDWLPTLAKLSQSDEIALYTYKELQYESLFRG… |
| A0A521R7Y2 | 4-200 | FAHGVTHETQWVTTGYSDVWQAELGYLARVPVHAPDCATDLYRSVQILPGIAHLARLGFIAMKTSTELKAEEYRLAPARLQGGSYYD… |
| A0A6N9RWQ7 | 1-246 | None |
| A0A2N2GQN4 | 47-300 | None |
| A0A433A4S1 | 18-203 | None |
| A0A291IEA3 | 1-211 | None |
| A0A6B1BRG0 | 97-368 | None |
| A0A285R5A7 | 45-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.