DPCstruct | MC46692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 6.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 53.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183MGD6 | 56-114 | YPTDFQSLNLGSCIKNDGDLFCQMYRRNSFCSIQHDECFCLPGYVSIYEMNDSWYTCKP |
| A0A158RET9 | 17-74 | GTWADEYHVVAAGPCAEEGDVYCSRRVPNSFCSVTKNECFCQPAFVAIQEEYGITCKP |
| A0A3P8BHZ6 | 215-279 | None |
| A0A448WW13 | 157-221 | None |
| A0A183QJR7 | 65-133 | None |
| A0A183QCL1 | 8-76 | None |
| A0A183WMU0 | 15-70 | None |
| A0A0R3TA48 | 1-58 | None |
| A0A0R3T769 | 22-90 | None |
| A0A0R3U7J3 | 18-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.