DPCstruct | MC46690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 80 ± 3 aa |
| Standard deviation of domain lengths | 3.37 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 56.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183M9H1 | 1-84 | RRVYRWFLFVHTVSYILGVGGYVLLVLTFFQVNLLFLLPTKVSVDLSLLALFYGLYYGVIARDFAEVCTNKLAAQISVSYAMYF |
| A0A1X7U592 | 95-170 | RIVYRWFLWIYQASYALGIIGYLVLLLVFTGLGLLLPVNPDVILETGVTLVFYGVYYGVMGRDCAEVCLDYMSAAM |
| A0A074ZA82 | 480-555 | None |
| A0A0N4U7N1 | 129-204 | None |
| A0A430PZM4 | 126-209 | None |
| A0A183EUC5 | 52-130 | None |
| M7AYQ9 | 102-184 | None |
| A0A6J0CIG4 | 133-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.