DPCstruct | MC4669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 581 ± 134 aa |
| Standard deviation of domain lengths | 133.66 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 75.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12340 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K0USD6 | 199-830 | LEFLLMAGESIIRSRQFRGMYIDPDQSVGTLVGFRSKLVLCNDQDPLVRIVLIPEGDIQFQRFSGHVTVNAAYGTADRVQAYRIDDL… |
| X0BYR4 | 46-485 | LYDSNWLKNPTNFLSSYWCRLHHAFQHNHIWLNKFELMVWIATVAYSAESDNQVTRALLLLALSTSVSTIPLPPDGQYDLSLGYNMK… |
| A0A175VPI5 | 583-1323 | None |
| T0LGS6 | 5-433 | None |
| A0A0F7ZXD5 | 2-370 | None |
| A0A813VKW9 | 3-665 | None |
| A0A4V6WJP3 | 1-301 | None |
| H0EN30 | 2-401 | None |
| A0A2K0UV93 | 1-764 | None |
| A0A7R7WCC1 | 147-789 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.