DPCstruct | MC46687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 400 ± 64 aa |
| Standard deviation of domain lengths | 64.32 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.48 |
| Pfam Score | 75.65 |
| Assigned Pfam label(s) | PF12145- PF09497 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317BL80 | 129-490 | KSGAPEVIVPPVYFPGGKPADLFPWTGNNAEDNLTETLVKAGVSNKPQIMNESNTARPSLINNLKNKSGLSTLSTLFVAVLEKRQQT… |
| A0A183M5C6 | 69-413 | WSFYYNVMLKKYECSNFQDFKKRQTTNIRDTVIPAIDMYKEQVCDWFRELSSNVPLQNLGRRVPFFKDKEEILHELLSNKVPITRAL… |
| A0A3N4IAZ2 | 1-395 | None |
| A0A6A4JIS2 | 150-512 | None |
| Q6C229 | 1-389 | None |
| J9EUC6 | 26-458 | None |
| J4IAQ4 | 29-482 | None |
| A0A183FFU1 | 15-512 | None |
| A0A0R3RTH2 | 64-480 | None |
| A0A7R8CKU8 | 1-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.