DPCstruct | MC46686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Standard deviation of domain lengths | 8.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 56.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183M471 | 1-102 | FLSNQSDPEWYELHLSVKDYCFGRTDRLVGVTVLSLSRALNLGATPIRLPLGRRLHFTETGWTVLRVLSQRVNTDDVAREFVRAKSE… |
| G3T0V1 | 182-274 | VSNENSPGAYELHLSVKDYCFAREDRIIGMTVIQLQNIAEKGSYGAWYPLLKNVSMDETGLTILRILSQRTNDDVAKEFVRLKSETR… |
| A0A4Y2DW43 | 493-582 | None |
| L5K1H3 | 857-949 | None |
| A0A4Z2GRX2 | 36-145 | None |
| A0A044S3H3 | 1630-1723 | None |
| A0A3Q0KMC8 | 2140-2231 | None |
| A0A7R9GVR8 | 209-305 | None |
| A0A654I7H4 | 1-112 | None |
| A0A7R9CQX4 | 256-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.