DPCstruct | MC46684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 204 ± 26 aa |
| Standard deviation of domain lengths | 26.17 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0048 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183M2W3 | 3-208 | TYWYVCLYYTYRSKSGILGWRSDRKETINNHPCQVYCASNVQIITLRRTEHLTEENLRDLNQQHNSNDNEHGGVCGVSGDDIVFPGG… |
| A0A0L0D815 | 302-516 | RSEIAVTDVPLENIEVAPATSWMGSLRFEEVNGYPCSVHNMSNIVVSTKTRNEHISPEIRAELEARRRRLAELEEVALEAENPDTLE… |
| A0A7S3BIQ5 | 1-198 | None |
| A0A7R9XYU9 | 230-478 | None |
| A0A5F8AB58 | 401-580 | None |
| A0A287HWW3 | 1-213 | None |
| T1H020 | 39-238 | None |
| A0A7R9FMX5 | 237-413 | None |
| A0A6H5HPM9 | 203-380 | None |
| U3I4V0 | 162-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.