DPCstruct | MC4668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 315 ± 37 aa |
| Standard deviation of domain lengths | 37.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0BS56 | 13-309 | LIADCRRFKYIRCKIPPGNAKRMDLILSPDQLAYFKEEWISGKPHPGSNQDPPQHRYRTGKLTENPRWTMPIHQINSIVLEIERWTN… |
| A0A559KT05 | 320-642 | AKRQHIPIVLPLVAVWLKTWDSESAFESRKGQLAWAFNALSNAAILTQAFHIVGSHKNHLNLWGTWSSSTQREVLEMLRTGNVGPKL… |
| A0A1V8SN61 | 800-1131 | None |
| A0A4U0V9D1 | 83-393 | None |
| W6Y889 | 209-449 | None |
| A0A194XV16 | 58-367 | None |
| W9ILS3 | 23-290 | None |
| J3PAN2 | 6-262 | None |
| A0A4U7AKG8 | 666-994 | None |
| A0A4S9G7N7 | 325-608 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.