DPCstruct | MC46678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 116 ± 9 aa |
| Standard deviation of domain lengths | 8.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 56.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379FJH3 | 1-108 | MILRQHLQADPEKASAMLKGVSQWQLNSAEEFRKVQKKIQDLVDSGQLGIFANGYWGHSAMKLPPEVNLIAVAHYLQALECQRDANR… |
| A0A447PAT6 | 42-167 | MDWIDVLNALKANPRATSQLAQSLSAWPMSSPGYFFDVQNRLKKFVDGGQLGIFRNGYWGHPQYKLSPEANLMGFAHYLEALDFQRE… |
| A0A1W1WVN2 | 117-230 | None |
| A0A379VPS7 | 1-126 | None |
| A0A1X7AAA4 | 64-189 | None |
| A0A182SDU7 | 61-178 | None |
| A0A6N6X8R0 | 32-133 | None |
| A0A2Z6TKL4 | 501-606 | None |
| A0A1B6NQE5 | 167-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.