DPCstruct | MC46677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 121 ± 12 aa |
| Standard deviation of domain lengths | 12.07 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379FIF9 | 1-137 | MKSKHKLGSYEYLCFIHELGHALGLMHINVYLKNIKNDAILTYKYSVMAYQFADIKDADFAGLYPMTFMLVDILLLQYLYGPNMTTR… |
| A0A365VQJ3 | 73-180 | VKGSYDYLTFVHEIGHALGLKHPFEASSDNSTILTPALDDVRYTVMSYNDSYSYQPTTPMLLDILAIQKLYGANTQYQSGNNFYSWA… |
| A0A448MKJ9 | 1-125 | None |
| A0A450YSY6 | 8-136 | None |
| A0A2E1V7P0 | 13-111 | None |
| T2IAN2 | 351-460 | None |
| A0A5E6UZF7 | 1-138 | None |
| A0A0Q4DED3 | 114-235 | None |
| A0A7H0GDX0 | 5-125 | None |
| A0A379Y7N4 | 53-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.