DPCstruct | MC46676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 131 ± 18 aa |
| Standard deviation of domain lengths | 17.69 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 48.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379FEY1 | 1-136 | MYPDILNYDQVVKVTGSFKTPMGCRSFLGVYEENGEMLHEGRNNLGVISLNLPRIAIEAKGDEAAFWSLLDKRLELAKKALMTRIAR… |
| A0A844VVY8 | 38-147 | KQLALECASKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVWENEDGEQVHDGRNNLGVISLNLPRIALEAKGDEAAFWALLDERLQ… |
| A0A377ZN02 | 1-170 | None |
| A0A090S659 | 268-398 | None |
| A0A3A6NMI8 | 337-501 | None |
| R6KS31 | 83-235 | None |
| A0A2X2BNV5 | 161-290 | None |
| T0D7I2 | 115-250 | None |
| T0D6Q3 | 1-148 | None |
| A0A0A2W4U6 | 666-800 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.