DPCstruct | MC46675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Standard deviation of domain lengths | 5.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 45.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2E4N7 | 27-91 | TLSAQNIRQLLANETPIIDVRAPIEFNQGAMPNAINLPLMNNEERAAVGTCYKQHGSQKSGRVGA |
| A0A136NFM8 | 12-69 | PHILQNDAVFLDTRSPAEYEHAHIPGALSFPLMSNEERAIIGTIYKQQGRQAAVTEGF |
| A0A432QZS9 | 7-73 | None |
| A0A4P1AYZ4 | 1-64 | None |
| A0A1S6YHL1 | 16-70 | None |
| A0A1B8NYE8 | 11-66 | None |
| A0A813DF83 | 50-102 | None |
| V9GEY6 | 17-70 | None |
| A0A0A1MH67 | 3-71 | None |
| R9VVR5 | 2-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.