DPCstruct | MC46674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Standard deviation of domain lengths | 9.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2DFX4 | 1-98 | MFFSQHGINRRDFMKLCAALSATMGLSGKAAAQMSQAMTSPERPPVIWIGAQECTGCTESLLRATHPTLENLVLDVIALEYHEVLSS… |
| P12943 | 2-83 | KFCTAVAVAMGMGPAFAPKVAEALTAKKRPSVVYLHNAECTGCSESLLRTVDPYVDELILDVISMDYHETLMAGAGHAVEEA |
| A0A101G1K4 | 1-107 | None |
| A0A4R6A2D8 | 2-105 | None |
| A0A376UIG1 | 1-119 | None |
| G1UYL0 | 2-105 | None |
| A0A2Z6TKL4 | 5-94 | None |
| A0A847P018 | 2-100 | None |
| A0A379FVJ8 | 8-101 | None |
| A0A7G2IUL2 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.