DPCstruct | MC46666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 85 ± 12 aa |
| Standard deviation of domain lengths | 12.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397STT5 | 2-76 | LDPHLDHRPFSAEEKEYIYKWVEKYRKTNNGNIQWKFLQPEMKKKFGKLRSLNDLKNVWNVRKRRLERLAKNDDE |
| A0A2Z6S1H0 | 38-113 | MLDPSLDHEPFSRDEKEYIYKWVEKHQKSNGGNIQWKFLQPEIEKEFGKFRSLNGLKNIWNVKKRQLERIIKDEES |
| A0A2I1F355 | 2-82 | None |
| A0A2I1F350 | 3-82 | None |
| A0A2Z6RJD5 | 121-207 | None |
| A0A2Z6RNS7 | 4-81 | None |
| A0A2H5S9L2 | 122-220 | None |
| A0A372QT81 | 70-163 | None |
| A0A2I1GZ21 | 69-148 | None |
| A0A2I1GZ36 | 114-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.