DPCstruct | MC46664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 182 ± 31 aa |
| Standard deviation of domain lengths | 30.73 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397SR06 | 2-191 | TSGYLPGICFACQRCLLCFNISQPNPCTCNKSIKPIRVNKPEHGQQIYPRIYTPDENLTIANNFLFAADAKFQYNNNFNAPFSFTFC… |
| A0A2I1FI44 | 1-134 | MSSVSISPRNYQIGVCFICQLCMYCGINLSFDNCNCNKDIKPIKNNHSKVVYFRNLIYKPEQVHEKTKNTLLHSNQTYGYKLDMKLP… |
| A0A2Z6QVV5 | 1-164 | None |
| A0A2Z6QTK5 | 8-178 | None |
| A0A2Z6QYJ5 | 2-144 | None |
| A0A397RZ48 | 1-184 | None |
| A0A2I1EPZ7 | 2-222 | None |
| A0A2Z6QL66 | 4-238 | None |
| A0A2I1FD93 | 17-198 | None |
| A0A2Z6R6E7 | 6-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.