DPCstruct | MC46662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 127 ± 15 aa |
| Standard deviation of domain lengths | 14.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 50.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397ILU9 | 267-424 | YGLLNLALWYQYYLWAGIWKAHRIGIRIGNHNLQRDALAVAAPLFPSAGKSNYATSIVQYLSLLTEFPDLNEKLQQVGAYKLPNLFD… |
| A0A397SH61 | 1-124 | MAKLTSNLWSMAYNRTFLIHKARIQIGNFNIQKCTLAALAPFLSSAKKSNYTQSVAHFFGILERYSKLVIKLQCVSSFKVSEEKRSY… |
| A0A397IHW3 | 7-129 | None |
| A0A2H5T2K6 | 35-163 | None |
| A0A015LNG5 | 2-121 | None |
| A0A397S3Y9 | 4-138 | None |
| A0A2Z6QYR4 | 1-99 | None |
| A0A2N0NUG6 | 572-685 | None |
| A0A2I1FFQ1 | 4-124 | None |
| A0A2P4QSR0 | 57-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.