DPCstruct | MC4666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 141 ± 10 aa |
| Standard deviation of domain lengths | 9.53 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 57.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0LVS5 | 159-303 | REELFPLQQGSDIHNIILDSYKGRKDGDGVNALLSQLTPVAEKITGKSGCWKRTNGSDLAKVPIPEWNDTTQDGYGGINVIGGFTAA… |
| X0BMS0 | 1-146 | MESMREELFPIQQGTDIHRFIMDSHEKSLRDEVNARVSRMTPSAEKITGKPGTYKSENGSTYDPPAKPEWNDKTKPGFGGINVIGGL… |
| A0A2H3U004 | 101-226 | None |
| A0A1B8A8G9 | 779-925 | None |
| A0A420M8V4 | 200-348 | None |
| A0A0S6XG16 | 360-484 | None |
| A0A4E9EIL4 | 376-525 | None |
| X0B816 | 382-516 | None |
| A0A2H3G828 | 1-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.