DPCstruct | MC46658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 124 ± 21 aa |
| Standard deviation of domain lengths | 20.97 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.37 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0023- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A136K0H3 | 141-255 | ELIDMRDVFKREGKDVGLSQELLDAISQAAQRGEQMIVLMNRRGFSQFVLCRSCGEMLKCKNCDITLTFHRREARLTCHYCGYGEPA… |
| A0A6I2IZT5 | 24-127 | LPSMKLVDTRRLQMKHGMSPQLLEAIGERLANKEQSLIFLNRRGFAPVLHCQSCGWVSNCPRCTAFTVLHRAGRGHRLQCHHCGYQA… |
| A0A7V6KW68 | 402-521 | None |
| A0A7V9EYB3 | 67-182 | None |
| T0THK9 | 1-92 | None |
| G6EPK4 | 86-199 | None |
| A0A0G1HHS4 | 322-464 | None |
| V9G3X6 | 295-421 | None |
| A0A098TM32 | 165-275 | None |
| A0A7V4S5M1 | 17-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.