DPCstruct | MC4665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 116 ± 11 aa |
| Standard deviation of domain lengths | 11.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4MTS2 | 1-102 | MCWHKRIIFSVCCHSRWGPETAKCDAEKAYEEGLRGEGCYQRWSQPRDVVRVEVKCRKCVLAKRRTDEQFARVKAVLTSLRKAVDAA… |
| X0BLF1 | 1-110 | MCYFDQIRWACGYWRWGHFRQQCNKEYRMGETCGLKLVYETRTARDKCKLCQDTGKKQRRYDKMYRDVQRWQREGNRNATIERTCAE… |
| A0A0J6F328 | 1-122 | None |
| F9GEG8 | 59-189 | None |
| A0A370TSM6 | 1-126 | None |
| A0A2H3G6J8 | 521-654 | None |
| A0A194X530 | 1-129 | None |
| A0A151GVJ7 | 149-257 | None |
| A0A6V8QY80 | 30-140 | None |
| A0A162ZKE8 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.