DPCstruct | MC46648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 140 ± 22 aa |
| Standard deviation of domain lengths | 21.81 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.16 |
| Pfam Score | 99.32 |
| Assigned Pfam label(s) | CL0028- CL0588 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2LZD0 | 34-184 | YSQFNVNRWPQFGSFSTANFFLPVYNNVNRCLPGDNQCIYDQKRRKANFLKLEEAHFFASPADNRIMPWQSSIFGRYSEVDTIEEIE… |
| A0A3Q2R0G7 | 44-166 | ISVCDYWNDPHHRADYLSGNTFLPLLNGEKPHMFMKEWRENFLRIKKLVMIGGPDDGVITPWQSSHYGFYNASEYVVEMKNQEFYKN… |
| A0A395SRY9 | 163-308 | None |
| A0A287Q2U8 | 70-198 | None |
| A0A7C9DKR8 | 10-130 | None |
| A0A1Z5S886 | 59-191 | None |
| K3WY25 | 2-155 | None |
| M9MGM4 | 161-320 | None |
| A0A7J0FTS3 | 231-358 | None |
| L8Y7H1 | 50-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.