DPCstruct | MC46647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 205 |
|---|---|
| Mean domain length (aa) | 146 ± 23 aa |
| Standard deviation of domain lengths | 22.66 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.43 |
| Pfam Score | 99.30 |
| Assigned Pfam label(s) | PF06212- PF03134- CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2LHA4 | 546-710 | MGASLSRCLCLGVGVAYPAYASFKALERPESGHGEKQWLTYWVVYGASTSVESVASPLLCLVPGYNITKTLFLIWMMSPQTKGATIV… |
| A0A183UYW1 | 225-346 | QLAYVVVGFLSLYLIIGECAQLVCNLIGFAYPAYASVKAIRTVEKDDDTQWLTYWTVFAFFSLLDFFAHVIMDVVPLYWLAKVIFLL… |
| A0A397IRU6 | 1-114 | None |
| A0A5N6PHN2 | 124-280 | None |
| A0A0M3IQN6 | 3-116 | None |
| A0A6P6FVL5 | 1-113 | None |
| A0A0B7N740 | 652-754 | None |
| A0A182KFL1 | 247-386 | None |
| Q66IF1 | 49-192 | None |
| D0N334 | 191-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.