DPCstruct | MC46646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 56 ± 4 aa |
| Standard deviation of domain lengths | 4.18 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7HIA0 | 1-56 | MDSEAVQVLTRWQDSGGTWRVLVRSDTHVTVALLTCTEEEVERCTWPSDPRLLALI |
| A0A7K2IP52 | 1-61 | MTTSENPQIRALRRWDEHGAPWRVLERTATRVTVSLETCDDGTEVDRLTSSDPEFLALVAR |
| A0A0Q8UWZ6 | 1-49 | None |
| A0A100XGR8 | 7-63 | None |
| A0A3D9L8C9 | 18-81 | None |
| A0A7Z0CPU4 | 1-49 | None |
| A0A316FFZ6 | 1-57 | None |
| A0A810M3X9 | 159-214 | None |
| A0A138A019 | 28-82 | None |
| A0A4P7S7H4 | 209-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.