DPCstruct | MC46641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 85 ± 12 aa |
| Standard deviation of domain lengths | 11.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4H6D7 | 1-88 | MDTSNGVLLPFYDPDTNVVYLCGKGDSSIRYFEITDEAPYVHFLNTFASKEPQRGMGYMPKRGLDVNKCEIARFYKLHERKCEPIVMT |
| A0A6J1VXM4 | 81-152 | SIVYLCGKGDSSIRYFEITEEAPYVHYLSTYSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIVMT |
| A0A7M4DXD3 | 152-255 | None |
| A0A493TV07 | 5-74 | None |
| A0A484CLL8 | 5-82 | None |
| A0A7R9WUR7 | 84-174 | None |
| A0A1I8FHF5 | 287-356 | None |
| A0A6I8SQE3 | 1-85 | None |
| A0A7J8GB50 | 108-179 | None |
| A0A4P9WF80 | 3-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.